SLC4A2 antibody (N-Term)
-
- Target See all SLC4A2 Antibodies
- SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC4A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC4 A2 antibody was raised against the N terminal of SLC4 2
- Purification
- Affinity purified
- Immunogen
- SLC4 A2 antibody was raised using the N terminal of SLC4 2 corresponding to a region with amino acids MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
- Top Product
- Discover our top product SLC4A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC4A2 Blocking Peptide, catalog no. 33R-6496, is also available for use as a blocking control in assays to test for specificity of this SLC4A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC4A2 (Solute Carrier Family 4, Anion Exchanger, Member 2 (erythrocyte Membrane Protein Band 3-Like 1) (SLC4A2))
- Alternative Name
- SLC4A2 (SLC4A2 Products)
- Synonyms
- AE2 antibody, BND3L antibody, EPB3L1 antibody, HKB3 antibody, NBND3 antibody, SLC4A2 antibody, B3RP antibody, Ae2 antibody, Aep2 antibody, AE 2 antibody, Anion exchanger 2 antibody, solute carrier family 4 member 2 antibody, anion exchange protein 2 antibody, solute carrier family 4 (anion exchanger), member 2 antibody, SLC4A2 antibody, LOC100599599 antibody, Slc4a2 antibody
- Background
- SLC4A2 is a plasma membrane anion exchange protein of wide distribution.
- Molecular Weight
- 137 kDa (MW of target protein)
-