OR6C68 antibody (N-Term)
-
- Target See all OR6C68 Antibodies
- OR6C68 (Olfactory Receptor, Family 6, Subfamily C, Member 68 (OR6C68))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This OR6C68 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OR6 C68 antibody was raised against the N terminal of OR6 68
- Purification
- Affinity purified
- Immunogen
- OR6 C68 antibody was raised using the N terminal of OR6 68 corresponding to a region with amino acids MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA
- Top Product
- Discover our top product OR6C68 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OR6C68 Blocking Peptide, catalog no. 33R-6330, is also available for use as a blocking control in assays to test for specificity of this OR6C68 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 68 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OR6C68 (Olfactory Receptor, Family 6, Subfamily C, Member 68 (OR6C68))
- Alternative Name
- OR6C68 (OR6C68 Products)
- Synonyms
- olfactory receptor family 6 subfamily C member 68 antibody, OR6C68 antibody
- Background
- Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
- Molecular Weight
- 36 kDa (MW of target protein)
-