SLC11A2 antibody (N-Term)
-
- Target See all SLC11A2 Antibodies
- SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC11A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC11 A2 antibody was raised against the N terminal Of Slc11 2
- Purification
- Affinity purified
- Immunogen
- SLC11 A2 antibody was raised using the N terminal Of Slc11 2 corresponding to a region with amino acids VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF
- Top Product
- Discover our top product SLC11A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC11A2 Blocking Peptide, catalog no. 33R-9663, is also available for use as a blocking control in assays to test for specificity of this SLC11A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC11A2 (Solute Carrier Family 11 (Proton-Coupled Divalent Metal Ion Transporters), Member 2 (SLC11A2))
- Alternative Name
- SLC11A2 (SLC11A2 Products)
- Synonyms
- DCT1 antibody, DMT1 antibody, NRAMP2 antibody, Nramp2 antibody, mk antibody, van antibody, Dmt1 antibody, ATNRAMP2 antibody, F8G22.4 antibody, F8G22_4 antibody, NRAMP metal ion transporter 2 antibody, dct1 antibody, dmt1 antibody, nramp2 antibody, SLC11A2 antibody, cb426 antibody, fa07b10 antibody, wu:fa07b10 antibody, zgc:136699 antibody, solute carrier family 11 member 2 antibody, solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 antibody, NRAMP metal ion transporter 2 antibody, manganese transport protein antibody, metal transporter Nramp2 antibody, solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2 antibody, SLC11A2 antibody, Slc11a2 antibody, NRAMP2 antibody, LOC9327403 antibody, slc11a2 antibody
- Background
- The SLC11A2 is a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport, Positive Regulation of Endopeptidase Activity
-