SLC6A1 antibody

Catalog No. ABIN635367

Product Details anti-SLC6A1 Antibody

Target: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC6A1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC6 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC6A1 Blocking Peptide, catalog no. 33R-1650, is also available for use as a blocking control in assays to test for specificity of this SLC6A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC6A1

Target: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Alternative Name: SLC6A1 (GAT1 Products)

Synonyms: GABATHG antibody, GABATR antibody, GAT1 antibody, A730043E01 antibody, GAT-1 antibody, Gabt antibody, Gabt1 antibody, Gat1 antibody, XT-1 antibody, Xtrp1 antibody, si:ch211-280e18.1 antibody, si:dkey-164m14.1 antibody, slc6a1 antibody, solute carrier family 6 member 1 antibody, solute carrier family 6 (neurotransmitter transporter, GABA), member 1 antibody, solute carrier family 6 (neurotransmitter transporter, GABA), member 1, like antibody, GABA neurotransmitter transporter 1 antibody, SLC6A1 antibody, Slc6a1 antibody, slc6a1l antibody, slc6a1 antibody

Background: SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.

Molecular Weight: 67 kDa (MW of target protein)