SLC12A8 antibody

Catalog No. ABIN635376

Product Details anti-SLC12A8 Antibody

Target: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC12A8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC12 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC12A8 Blocking Peptide, catalog no. 33R-4006, is also available for use as a blocking control in assays to test for specificity of this SLC12A8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC12A8

Target: SLC12A8 (Slc12a8) (Solute Carrier Family 12 (Potassium/chloride Transporters), Member 8 (Slc12a8))

Alternative Name: SLC12A8 (Slc12a8 Products)

Synonyms: CCC9 antibody, E330020C02Rik antibody, Ccc9 antibody, solute carrier family 12 member 8 antibody, zinc finger protein 148 antibody, solute carrier family 12 (potassium/chloride transporters), member 8 antibody, solute carrier family 12, member 8 antibody, solute carrier family 12, member 8 L homeolog antibody, SLC12A8 antibody, ZNF148 antibody, Slc12a8 antibody, slc12a8.L antibody

Background: SLC12A8 is a cation/chloride cotransporter that may play a role in the control of keratinocyte proliferation.

Molecular Weight: 78 kDa (MW of target protein)