FAM134B antibody (Family with Sequence Similarity 134, Member B) (Middle Region)

Details for Product anti-FAM134B Antibody No. ABIN635407
Antigen
Epitope
Middle Region
5
4
3
2
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
32
21
21
5
4
4
4
4
2
1
1
1
Host
Rabbit
29
3
Clonality
Polyclonal
Conjugate
This FAM134B antibody is un-conjugated
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
16
13
5
5
5
Options
Immunogen FAM134 B antibody was raised using the middle region of FAM134 corresponding to a region with amino acids DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV
Specificity FAM134 B antibody was raised against the middle region of FAM134
Purification Affinity purified
Antigen
Alternative Name FAM134B (FAM134B Antibody Abstract)
Background FAM134B is a cis-Golgi transmembrane protein that may be necessary for the long-term survival of nociceptive and autonomic ganglion neurons. Defects in this gene are a cause of hereditary sensory and autonomic neuropathy type II (HSAN II).
Molecular Weight 55 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

FAM134B Blocking Peptide, catalog no. 33R-1928, is also available for use as a blocking control in assays to test for specificity of this FAM134B antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Family with Sequence Similarity 134, Member B (FAM134B) (Middle Region) antibody (ABIN635407) FAM134B antibody used at 1 ug/ml to detect target protein.