Integrin beta 5 antibody (Middle Region)

Catalog No. ABIN635415

Product Details anti-Integrin beta 5 Antibody

Target: Integrin beta 5 (ITGB5)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Integrin beta 5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Integrin Beta 5 antibody was raised against the middle region of ITGB5

Purification: Affinity purified

Immunogen: Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Integrin Beta 5 Blocking Peptide, catalog no. 33R-4936, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Integrin beta 5

Target: Integrin beta 5 (ITGB5)

Alternative Name: Integrin beta 5 (ITGB5 Products)

Synonyms: ITGB5 antibody, AA475909 antibody, AI874634 antibody, ESTM23 antibody, [b]-5 antibody, [b]5 antibody, [b]5A antibody, [b]5B antibody, beta-5 antibody, beta5 antibody, RGD1563276 antibody, integrin, beta 5 antibody, integrin beta 5 antibody, integrin subunit beta 5 antibody, ITGB5 antibody, Itgb5 antibody

Background: Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognises the sequence R-G-D in its ligand.

Molecular Weight: 88 kDa (MW of target protein)

Pathways: Integrin Complex