ATP6V0A1 antibody (N-Term)

Catalog No. ABIN635431

Product Details anti-ATP6V0A1 Antibody

Target: ATP6V0A1 (ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP6V0A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP6 V6 1 antibody was raised against the N terminal of ATP6 6 1

Purification: Affinity purified

Immunogen: ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP6V0A1 Blocking Peptide, catalog no. 33R-7853, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP6V0A1

Target: ATP6V0A1 (ATPase, H+ Transporting, Lysosomal V0 Subunit A1 (ATP6V0A1))

Alternative Name: ATP6V0A1 (ATP6V0A1 Products)

Synonyms: ATP6N1 antibody, ATP6N1A antibody, Stv1 antibody, VPP1 antibody, Vph1 antibody, a1 antibody, AA959968 antibody, ATP6a1 antibody, Atp6n1 antibody, Atp6n1a antibody, Atpv0a1 antibody, Vpp-1 antibody, Vpp1 antibody, A1 antibody, wu:fj37e01 antibody, zgc:112214 antibody, atp6v0a1 antibody, wu:fc25b09 antibody, zgc:76965 antibody, ATPase H+ transporting V0 subunit a1 antibody, ATPase, H+ transporting, lysosomal V0 subunit A1 antibody, si:ch73-173p19.2 antibody, ATPase, H+ transporting, lysosomal V0 subunit a1 L homeolog antibody, ATPase, H+ transporting, lysosomal V0 subunit a1b antibody, ATPase, H+ transporting, lysosomal V0 subunit a1a antibody, ATP6V0A1 antibody, Atp6v0a1 antibody, si:ch73-173p19.2 antibody, atp6v0a1.L antibody, atp6v0a1b antibody, atp6v0a1a antibody

Background: ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles.

Molecular Weight: 96 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport