LRRC8B antibody (N-Term)

Catalog No. ABIN635448

Product Details anti-LRRC8B Antibody

Target: LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC8B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC8 B antibody was raised against the N terminal of LRRC8

Purification: Affinity purified

Immunogen: LRRC8 B antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC8B Blocking Peptide, catalog no. 33R-7375, is also available for use as a blocking control in assays to test for specificity of this LRRC8B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC8B

Target: LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))

Alternative Name: LRRC8B (LRRC8B Products)

Synonyms: TA-LRRP antibody, TALRRP antibody, R75581 antibody, Ta-lrrp antibody, mKIAA0231 antibody, RGD1563429 antibody, leucine rich repeat containing 8 family member B antibody, leucine rich repeat containing 8 VRAC subunit B S homeolog antibody, leucine rich repeat containing 8 VRAC subunit B antibody, leucine rich repeat containing 8 family, member B antibody, LRRC8B antibody, lrrc8b.S antibody, lrrc8b antibody, Lrrc8b antibody

Background: The function of LRRC8B protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 92 kDa (MW of target protein)