ATP10D antibody (C-Term)

Catalog No. ABIN635469

Product Details anti-ATP10D Antibody

Target: ATP10D (ATPase, Class V, Type 10D (ATP10D))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP10D antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ATP10 D antibody was raised against the C terminal of ATP10

Purification: Affinity purified

Immunogen: ATP10 D antibody was raised using the C terminal of ATP10 corresponding to a region with amino acids LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATP10D Blocking Peptide, catalog no. 33R-4952, is also available for use as a blocking control in assays to test for specificity of this ATP10D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP10D

Target: ATP10D (ATPase, Class V, Type 10D (ATP10D))

Alternative Name: ATP10D (ATP10D Products)

Synonyms: ATP10D antibody, atp10d antibody, MGC185750 antibody, ATPVD antibody, 9830145H18Rik antibody, D5Buc24e antibody, ATPase phospholipid transporting 10D (putative) antibody, ATPase, class V, type 10D antibody, ATP10D antibody, atp10d antibody, Atp10d antibody

Background: ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.

Molecular Weight: 160 kDa (MW of target protein)