Junctophilin 2 antibody (Middle Region)

Catalog No. ABIN635496

Product Details anti-Junctophilin 2 Antibody

Target: Junctophilin 2 (JPH2)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Junctophilin 2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Junctophilin 2 antibody was raised against the middle region of JPH2

Purification: Affinity purified

Immunogen: Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Junctophilin 2 Blocking Peptide, catalog no. 33R-1407, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Junctophilin 2

Target: Junctophilin 2 (JPH2)

Alternative Name: Junctophilin 2 (JPH2 Products)

Background: Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.

Molecular Weight: 74 kDa (MW of target protein)