Junctophilin 2 antibody (Middle Region)
-
- Target See all Junctophilin 2 (JPH2) Antibodies
- Junctophilin 2 (JPH2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Junctophilin 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Junctophilin 2 antibody was raised against the middle region of JPH2
- Purification
- Affinity purified
- Immunogen
- Junctophilin 2 antibody was raised using the middle region of JPH2 corresponding to a region with amino acids ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA
- Top Product
- Discover our top product JPH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Junctophilin 2 Blocking Peptide, catalog no. 33R-1407, is also available for use as a blocking control in assays to test for specificity of this Junctophilin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JPH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Junctophilin 2 (JPH2)
- Alternative Name
- Junctophilin 2 (JPH2 Products)
- Background
- Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH2 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane.
- Molecular Weight
- 74 kDa (MW of target protein)
-