NAT8B antibody
-
- Target See all NAT8B Antibodies
- NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NAT8B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NAT8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA
- Top Product
- Discover our top product NAT8B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NAT8B Blocking Peptide, catalog no. 33R-8328, is also available for use as a blocking control in assays to test for specificity of this NAT8B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAT8B (N-Acetyltransferase 8B (GCN5-Related, Putative, Gene/pseudogene) (NAT8B))
- Alternative Name
- NAT8B (NAT8B Products)
- Synonyms
- EG434057 antibody, Cml1 antibody, Cml6 antibody, Nat8 antibody, RGD621605 antibody, CML2 antibody, Hcml2 antibody, NAT8BP antibody, N-acetyltransferase 8B antibody, N-acetyltransferase 8B, pseudogene antibody, N-acetyltransferase 8B (putative, gene/pseudogene) antibody, NAT8B antibody, Nat8b-ps antibody, Nat8b antibody
- Background
- The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance.
- Molecular Weight
- 25 kDa (MW of target protein)
-