NTSR1 antibody

Catalog No. ABIN635539

Product Details anti-NTSR1 Antibody

Target: NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NTSR1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NTSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NTSR1 Blocking Peptide, catalog no. 33R-2909, is also available for use as a blocking control in assays to test for specificity of this NTSR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NTSR1

Target: NTSR1 (Neurotensin Receptor 1 (High Affinity) (NTSR1))

Alternative Name: NTSR1 (NTSR1 Products)

Synonyms: NTSR1 antibody, Ntsr antibody, NT-1R antibody, NTR-1 antibody, NTR1 antibody, NTR antibody, neurotensin receptor 1 antibody, neurotensin receptor 1 (high affinity) antibody, NTSR1 antibody, Ntsr1 antibody

Background: Neurotensin receptor 1 belongs to the large superfamily of G-protein coupled receptors. NTSR1 mediates the multiple functions of neurotensin, such as hypotension, hyperglycemia, hypothermia and antinociception.

Molecular Weight: 46 kDa (MW of target protein)