VTI1A antibody

Catalog No. ABIN635544

Product Details anti-VTI1A Antibody

Target: VTI1A (Vesicle Transport through Interaction with t-SNAREs 1A (VTI1A))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VTI1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: VTI1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VTI1A Blocking Peptide, catalog no. 33R-8790, is also available for use as a blocking control in assays to test for specificity of this VTI1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTI0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VTI1A

Target: VTI1A (Vesicle Transport through Interaction with t-SNAREs 1A (VTI1A))

Alternative Name: VTI1A (VTI1A Products)

Synonyms: zgc:109895 antibody, mvti1 antibody, vti1-rp2 antibody, DDBDRAFT_0219803 antibody, DDBDRAFT_0231536 antibody, DDB_0219803 antibody, DDB_0231536 antibody, MMDS3 antibody, MVti1 antibody, VTI1RP2 antibody, Vti1-rp2 antibody, 1110014F16Rik antibody, 1110018K19Rik antibody, 4921537J05Rik antibody, MVti1a antibody, Vti1 antibody, vesicle transport through interaction with t-SNAREs 1A L homeolog antibody, vesicle transport through interaction with t-SNAREs 1A antibody, v-SNARE family protein antibody, vti1a.L antibody, vti1a antibody, VTI1A antibody, vti1A antibody, Vti1a antibody

Background: VTI1A is a V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. VTI1A may be concerned with increased secretion of cytokines associated with cellular senescence.

Molecular Weight: 25 kDa (MW of target protein)