POMT1 antibody (Middle Region)

Catalog No. ABIN635552

Product Details anti-POMT1 Antibody

Target: POMT1 (Protein-O-Mannosyltransferase 1 (POMT1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POMT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POMT1 antibody was raised against the middle region of POMT1

Purification: Affinity purified

Immunogen: POMT1 antibody was raised using the middle region of POMT1 corresponding to a region with amino acids LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POMT1 Blocking Peptide, catalog no. 33R-5473, is also available for use as a blocking control in assays to test for specificity of this POMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POMT1

Target: POMT1 (Protein-O-Mannosyltransferase 1 (POMT1))

Alternative Name: POMT1 (POMT1 Products)

Synonyms: LGMD2K antibody, MDDGA1 antibody, MDDGB1 antibody, MDDGC1 antibody, RT antibody, AI505244 antibody, protein O-mannosyltransferase 1 antibody, protein-O-mannosyltransferase 1 antibody, POMT1 antibody, Pomt1 antibody

Background: POMT1 is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K).

Molecular Weight: 82 kDa (MW of target protein)