Coxsackie Adenovirus Receptor antibody (N-Term)

Catalog No. ABIN635555

Product Details anti-Coxsackie Adenovirus Receptor Antibody

Target: Coxsackie Adenovirus Receptor (CXADR) (Coxsackie Virus and Adenovirus Receptor (CXADR))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Coxsackie Adenovirus Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CXADR antibody was raised against the N terminal of CXADR

Purification: Affinity purified

Immunogen: CXADR antibody was raised using the N terminal of CXADR corresponding to a region with amino acids ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CXADR Blocking Peptide, catalog no. 33R-4065, is also available for use as a blocking control in assays to test for specificity of this CXADR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXADR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Coxsackie Adenovirus Receptor

Target: Coxsackie Adenovirus Receptor (CXADR) (Coxsackie Virus and Adenovirus Receptor (CXADR))

Alternative Name: CXADR (CXADR Products)

Synonyms: CAR antibody, CAR4/6 antibody, HCAR antibody, Car1 antibody, car antibody, cb331 antibody, fb76g12 antibody, wu:fb76g12 antibody, 2610206D03Rik antibody, AU016810 antibody, AW553441 antibody, MCAR antibody, MCVADR antibody, hcar antibody, xCAR antibody, CXADR antibody, CXADR, Ig-like cell adhesion molecule antibody, coxsackie virus and adenovirus receptor antibody, CXADR, Ig-like cell adhesion molecule L homeolog antibody, CXADR antibody, Cxadr antibody, cxadr antibody, cxadr.L antibody

Background: The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization