TMEM74 antibody (Middle Region)
-
- Target See all TMEM74 Antibodies
- TMEM74 (Transmembrane Protein 74 (TMEM74))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM74 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM74 antibody was raised against the middle region of TMEM74
- Purification
- Affinity purified
- Immunogen
- TMEM74 antibody was raised using the middle region of TMEM74 corresponding to a region with amino acids ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR
- Top Product
- Discover our top product TMEM74 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM74 Blocking Peptide, catalog no. 33R-2701, is also available for use as a blocking control in assays to test for specificity of this TMEM74 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM74 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM74 (Transmembrane Protein 74 (TMEM74))
- Alternative Name
- TMEM74 (TMEM74 Products)
- Synonyms
- NET36 antibody, AA549547 antibody, B230382K22Rik antibody, RGD1566279 antibody, transmembrane protein 74 antibody, Transmembrane protein 74 antibody, TMEM74 antibody, tmm74 antibody, Tmem74 antibody
- Background
- TMEM74 plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.
- Molecular Weight
- 33 kDa (MW of target protein)
-