PILRA antibody (N-Term)

Catalog No. ABIN635597

Product Details anti-PILRA Antibody

Target: PILRA (Paired Immunoglobin-Like Type 2 Receptor alpha (PILRA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PILRA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PILRA antibody was raised against the N terminal of PILRA

Purification: Affinity purified

Immunogen: PILRA antibody was raised using the N terminal of PILRA corresponding to a region with amino acids IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PILRA Blocking Peptide, catalog no. 33R-4090, is also available for use as a blocking control in assays to test for specificity of this PILRA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PILRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PILRA

Target: PILRA (Paired Immunoglobin-Like Type 2 Receptor alpha (PILRA))

Alternative Name: PILRA (PILRA Products)

Synonyms: PILRA antibody, FDF03 antibody, AV021745 antibody, RGD1562847 antibody, paired immunoglobin like type 2 receptor alpha antibody, paired immunoglobulin-like type 2 receptor alpha antibody, paired immunoglobin-like type 2 receptor alpha antibody, PILRA antibody, LOC489841 antibody, Pilra antibody

Background: Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role.

Molecular Weight: 18 kDa (MW of target protein)