MTUS1 antibody (Middle Region)
-
- Target See all MTUS1 Antibodies
- MTUS1 (Microtubule Associated Tumor Suppressor 1 (MTUS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTUS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MTUS1 antibody was raised against the middle region of MTUS1
- Purification
- Affinity purified
- Immunogen
- MTUS1 antibody was raised using the middle region of MTUS1 corresponding to a region with amino acids KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR
- Top Product
- Discover our top product MTUS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTUS1 Blocking Peptide, catalog no. 33R-4631, is also available for use as a blocking control in assays to test for specificity of this MTUS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTUS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTUS1 (Microtubule Associated Tumor Suppressor 1 (MTUS1))
- Alternative Name
- MTUS1 (MTUS1 Products)
- Synonyms
- ATBP antibody, ATIP antibody, ICIS antibody, MP44 antibody, MTSG1 antibody, AI481402 antibody, ATBP135 antibody, Atip1 antibody, B430010I23Rik antibody, B430305I03Rik antibody, C85752 antibody, Cctsg1-440 antibody, MD44 antibody, mKIAA1288 antibody, ATIP4 antibody, Atip3b antibody, Mtsg1 antibody, fbx27 antibody, fa17d11 antibody, wu:fa17d11 antibody, wu:fi18f08 antibody, zgc:154168 antibody, microtubule associated scaffold protein 1 antibody, mitochondrial tumor suppressor 1 antibody, microtubule associated scaffold protein 1 L homeolog antibody, microtubule associated tumor suppressor 1 antibody, microtubule associated tumor suppressor 1a antibody, MTUS1 antibody, Mtus1 antibody, mtus1.L antibody, mtus1a antibody
- Background
- MTUS1 contains a C-terminal domain and is able to interact with the angiotension II (AT2) receptor and a large coiled-coil region allowing dimerization. One of the isoforms has been shown to be a mitochondrial protein that acts as a tumor suppressor and partcipates in AT2 signaling pathways. Other isoforms may be nuclear or transmembrane proteins but it has not been determined whether they also participate in AT2 signaling pathways.
- Molecular Weight
- 141 kDa (MW of target protein)
-