SLC22A8 antibody
-
- Target See all SLC22A8 Antibodies
- SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SLC22 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS
- Top Product
- Discover our top product SLC22A8 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A8 Blocking Peptide, catalog no. 33R-7064, is also available for use as a blocking control in assays to test for specificity of this SLC22A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))
- Alternative Name
- SLC22A8 (SLC22A8 Products)
- Synonyms
- OAT3 antibody, Oat3 antibody, Roct antibody, OCT3 antibody, solute carrier family 22 member 8 antibody, solute carrier family 22 (organic anion transporter), member 8 antibody, SLC22A8 antibody, Slc22a8 antibody
- Background
- SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.
- Molecular Weight
- 60 kDa (MW of target protein)
-