SUSD3 antibody (N-Term)

Catalog No. ABIN635664

Product Details anti-SUSD3 Antibody

Target: SUSD3 (Sushi Domain Containing 3 (SUSD3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SUSD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SUSD3 antibody was raised against the N terminal of SUSD3

Purification: Affinity purified

Immunogen: SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SUSD3 Blocking Peptide, catalog no. 33R-5371, is also available for use as a blocking control in assays to test for specificity of this SUSD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SUSD3

Target: SUSD3 (Sushi Domain Containing 3 (SUSD3))

Alternative Name: SUSD3 (SUSD3 Products)

Synonyms: 1700017I11Rik antibody, 2810440J20Rik antibody, sushi domain containing 3 antibody, SUSD3 antibody, Susd3 antibody

Background: The function of SUSD3 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 27 kDa (MW of target protein)