DENND1B antibody (Middle Region)

Catalog No. ABIN635666

Product Details anti-DENND1B Antibody

Target: DENND1B (DENN/MADD Domain Containing 1B (DENND1B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DENND1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DENND1 B antibody was raised against the middle region of DENND1

Purification: Affinity purified

Immunogen: DENND1 B antibody was raised using the middle region of DENND1 corresponding to a region with amino acids PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DENND1B Blocking Peptide, catalog no. 33R-7416, is also available for use as a blocking control in assays to test for specificity of this DENND1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DENND1B

Target: DENND1B (DENN/MADD Domain Containing 1B (DENND1B))

Alternative Name: DENND1B (DENND1B Products)

Synonyms: C1ORF18 antibody, C1orf218 antibody, FAM31B antibody, 4632404N19Rik antibody, 4930467M19Rik antibody, 6820401H01Rik antibody, F730008N07Rik antibody, Fam31b antibody, si:ch211-195i21.1 antibody, DENN domain containing 1B antibody, DENN/MADD domain containing 1B antibody, DENND1B antibody, dennd1b antibody, Dennd1b antibody

Background: DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.

Molecular Weight: 45 kDa (MW of target protein)