RPN1 antibody (Middle Region)

Catalog No. ABIN635681

Product Details anti-RPN1 Antibody

Target: RPN1 (Ribophorin 1 (RPN1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Ribophorin I antibody was raised against the middle region of RPN1

Purification: Affinity purified

Immunogen: Ribophorin I antibody was raised using the middle region of RPN1 corresponding to a region with amino acids AAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ribophorin I Blocking Peptide, catalog no. 33R-1015, is also available for use as a blocking control in assays to test for specificity of this Ribophorin I antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPN1

Target: RPN1 (Ribophorin 1 (RPN1))

Alternative Name: Ribophorin I (RPN1 Products)

Synonyms: OST1 antibody, RBPH1 antibody, AU018702 antibody, D6Wsu137e antibody, Rpn-1 antibody, RIBI antibody, wu:fa12h07 antibody, wu:fc68b07 antibody, wu:fc88a12 antibody, ost1 antibody, xrpn1 antibody, ribophorin I antibody, ribophorin I L homeolog antibody, PVX_119685 antibody, NAEGRDRAFT_78171 antibody, RPN1 antibody, Rpn1 antibody, rpn1 antibody, rpn1.L antibody

Background: This protein is a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome.

Molecular Weight: 66 kDa (MW of target protein)