CYP46A1 antibody (C-Term)

Catalog No. ABIN635703

Product Details anti-CYP46A1 Antibody

Target: CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP46A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP46 A1 antibody was raised against the C terminal of CYP46 1

Purification: Affinity purified

Immunogen: CYP46 A1 antibody was raised using the C terminal of CYP46 1 corresponding to a region with amino acids YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP46A1 Blocking Peptide, catalog no. 33R-10280, is also available for use as a blocking control in assays to test for specificity of this CYP46A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP46A1

Target: CYP46A1 (Cytochrome P450, Family 46, Subfamily A, Polypeptide 1 (CYP46A1))

Alternative Name: CYP46A1 (CYP46A1 Products)

Synonyms: CP46 antibody, CYP46 antibody, CYP46A1 antibody, zgc:109896 antibody, MGC147389 antibody, Cyp46 antibody, cytochrome P450 family 46 subfamily A member 1 antibody, cytochrome P450 family 46 subfamily A member 1 L homeolog antibody, cytochrome P450, family 46, subfamily A, polypeptide 1, tandem duplicate 1 antibody, cytochrome P450, family 46 antibody, cytochrome P450 46A1 antibody, cytochrome P450, family 46, subfamily a, polypeptide 1 antibody, cholesterol 24-hydroxylase antibody, cytochrome P450, family 46, subfamily A, polypeptide 1 antibody, CYP46A1 antibody, cyp46a1.L antibody, cyp46a1.1 antibody, cyp46a1 antibody, PTRG_08343 antibody, PTRG_09667 antibody, Cyp46a1 antibody, Sgly_1093 antibody

Background: CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 57 kDa (MW of target protein)