Reticulon 4 antibody (Middle Region)
-
- Target See all Reticulon 4 (RTN4) Antibodies
- Reticulon 4 (RTN4)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Reticulon 4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RTN4 antibody was raised against the middle region of RTN4
- Purification
- Affinity purified
- Immunogen
- RTN4 antibody was raised using the middle region of RTN4 corresponding to a region with amino acids RAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
- Top Product
- Discover our top product RTN4 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RTN4 Blocking Peptide, catalog no. 33R-7833, is also available for use as a blocking control in assays to test for specificity of this RTN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Reticulon 4 (RTN4)
- Alternative Name
- RTN4 (RTN4 Products)
- Synonyms
- ASY antibody, NI220/250 antibody, NOGO antibody, NOGO-A antibody, NOGOC antibody, NSP antibody, NSP-CL antibody, Nbla00271 antibody, Nbla10545 antibody, Nogo-B antibody, Nogo-C antibody, RTN-X antibody, RTN4-A antibody, RTN4-B1 antibody, RTN4-B2 antibody, RTN4-C antibody, RTN4-Cw antibody, DKFZp459C0314 antibody, 1110020G17Rik antibody, AA407876 antibody, AA409940 antibody, AA960376 antibody, C130026I10Rik antibody, NgA antibody, Nogo-A antibody, mKIAA0886 antibody, mKIAA4153 antibody, NI-250 antibody, Nogo antibody, Vp20 antibody, r antibody, rat N antibody, rat NogoA antibody, reticulon-4 antibody, nogo antibody, rtn4 antibody, wu:fb17a02 antibody, wu:fb22f12 antibody, wu:fd61a07 antibody, zgc:92163 antibody, reticulon 4 antibody, reticulon 4a antibody, RTN4 antibody, rtn4 antibody, Rtn4 antibody, rtn4a antibody
- Background
- RTN4 belongs to the family of reticulons. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. RTN4 is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, Regulation of Cell Size, SARS-CoV-2 Protein Interactome
-