ABCA12 antibody

Catalog No. ABIN635729

Product Details anti-ABCA12 Antibody

Target: ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCA12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCA12 Blocking Peptide, catalog no. 33R-9318, is also available for use as a blocking control in assays to test for specificity of this ABCA12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCA12

Target: ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))

Alternative Name: ABCA12 (ABCA12 Products)

Synonyms: cb352 antibody, sb:cb352 antibody, ARCI4A antibody, ARCI4B antibody, ICR2B antibody, LI2 antibody, 4832428G11Rik antibody, 4833417A11Rik antibody, ATP binding cassette subfamily A member 12 antibody, ATP-binding cassette, sub-family A (ABC1), member 12 antibody, ABCA12 antibody, abca12 antibody, Abca12 antibody

Background: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes.

Molecular Weight: 257 kDa (MW of target protein)