LRFN3 antibody (C-Term)

Catalog No. ABIN635732

Product Details anti-LRFN3 Antibody

Target: LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRFN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRFN3 antibody was raised against the C terminal of LRFN3

Purification: Affinity purified

Immunogen: LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRFN3 Blocking Peptide, catalog no. 33R-9926, is also available for use as a blocking control in assays to test for specificity of this LRFN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRFN3

Target: LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))

Alternative Name: LRFN3 (LRFN3 Products)

Synonyms: FIGLER1 antibody, SALM4 antibody, A530045B06Rik antibody, Salm4 antibody, LRFN3 antibody, leucine rich repeat and fibronectin type III domain containing 3 antibody, LRFN3 antibody, Lrfn3 antibody

Background: LRFN3 belongs to the LRFN family. Its exact function remains unknown.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Synaptic Membrane