DNASE2B antibody (Middle Region)
-
- Target See all DNASE2B Antibodies
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DNASE2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DNASE2 B antibody was raised against the middle region of DNASE2
- Purification
- Affinity purified
- Immunogen
- DNASE2 B antibody was raised using the middle region of DNASE2 corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
- Top Product
- Discover our top product DNASE2B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DNASE2B Blocking Peptide, catalog no. 33R-4011, is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNASE2B (Deoxyribonuclease II beta (DNASE2B))
- Alternative Name
- DNASE2B (DNASE2B Products)
- Synonyms
- DNASE2 antibody, deoxyribonuclease-2-beta antibody, DLAD antibody, DNASE2B antibody, dnase2b antibody, AI526873 antibody, Dlad antibody, DnaseIIb antibody, UOX antibody, deoxyribonuclease 2 beta antibody, deoxyribonuclease II beta antibody, DNASE2B antibody, dnase2b antibody, Dnase2b antibody
- Background
- DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.
- Molecular Weight
- 39 kDa (MW of target protein)
-