C1QTNF1 antibody (N-Term)
-
- Target See all C1QTNF1 Antibodies
- C1QTNF1 (C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1QTNF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C1 QTNF1 antibody was raised against the N terminal of C1 TNF1
- Purification
- Affinity purified
- Immunogen
- C1 QTNF1 antibody was raised using the N terminal of C1 TNF1 corresponding to a region with amino acids YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS
- Top Product
- Discover our top product C1QTNF1 Primary Antibody
-
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (AA 32-61), (N-Term) antibody
C1QTNF1 Reactivity: Human WB, IHC (p), FACS Host: Rabbit Polyclonal RB19744 unconjugated
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (AA 26-281) antibodyC1QTNF1 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 4A10 unconjugated
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) antibodyC1QTNF1 Reactivity: Human WB, ELISA, IHC, IP Host: Guinea Pig Polyclonal unconjugated
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (AA 26-281) antibodyC1QTNF1 Reactivity: Human ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (AA 1-281) antibodyC1QTNF1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (N-Term) antibodyC1QTNF1 Reactivity: Human, Mouse, Rat, Guinea Pig, Horse, Rabbit, Cow, Zebrafish (Danio rerio), Dog, Monkey, Drosophila melanogaster WB Host: Rabbit Polyclonal unconjugated
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (AA 26-281) antibodyC1QTNF1 Reactivity: Human WB, IHC, ICC Host: Rabbit Polyclonal unconjugated
anti-C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1) (N-Term) antibodyC1QTNF1 Reactivity: Human, Mouse, Rat WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C1QTNF1 Blocking Peptide, catalog no. 33R-10194, is also available for use as a blocking control in assays to test for specificity of this C1QTNF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 TNF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1QTNF1 (C1q and Tumor Necrosis Factor Related Protein 1 (C1QTNF1))
- Alternative Name
- C1QTNF1 (C1QTNF1 Products)
- Synonyms
- C1QTNF1 antibody, CTRP1 antibody, GIP antibody, ZSIG37 antibody, 1600017K21Rik antibody, Zsig37 antibody, Ctrp1 antibody, zgc:113062 antibody, C1q and tumor necrosis factor related protein 1 antibody, C1q and TNF related 1 antibody, C1QTNF1 antibody, c1qtnf1 antibody, C1qtnf1 antibody
- Background
- C1QTNF1 may be considered a novel adipokine, providing an important framework to further address the physiological functions and mechanisms of the action of this family of secreted glycoproteins in normal and disease states.
- Molecular Weight
- 23 kDa (MW of target protein)
-
