FZD2 antibody

Catalog No. ABIN635757

Product Details anti-FZD2 Antibody

Target: FZD2 (Frizzled Family Receptor 2 (FZD2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FZD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD2 Blocking Peptide, catalog no. 33R-6374, is also available for use as a blocking control in assays to test for specificity of this FZD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD2

Target: FZD2 (Frizzled Family Receptor 2 (FZD2))

Alternative Name: FZD2 (FZD2 Products)

Synonyms: BG01711 antibody, CG9739 antibody, D-Fz2 antibody, D-fz2 antibody, DFZ2 antibody, DFz-2 antibody, DFz2 antibody, Dfrz2 antibody, Dfz2 antibody, Dfz[[2]] antibody, Dm Fz2 antibody, Dmel\\CG9739 antibody, FZ2 antibody, Fz2 antibody, dFz2 antibody, dfz(2) antibody, dfz2 antibody, dfz2r antibody, frz2 antibody, fz-2 antibody, fz8 antibody, zfz2 antibody, zg08 antibody, cb383 antibody, wu:fb70g09 antibody, FZD2 antibody, fzE2 antibody, hFz2 antibody, Fz-10 antibody, Fzd10 antibody, cFz-2 antibody, frizzled2 antibody, fz2 antibody, xfz2 antibody, AL033370 antibody, AW456835 antibody, Fz10 antibody, Mfz10 antibody, Mfz10a antibody, frizzled 2 antibody, frizzled class receptor 2 antibody, frizzled class receptor 2 S homeolog antibody, fz2 antibody, fzd2 antibody, FZD2 antibody, Fzd2 antibody, fzd2.S antibody

Background: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: WNT Signaling