ADAM19 antibody

Catalog No. ABIN635783

Product Details anti-ADAM19 Antibody

Target: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM19 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ADAM19 antibody was raised using a synthetic peptide corresponding to a region with amino acids VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM19 Blocking Peptide, catalog no. 33R-9408, is also available for use as a blocking control in assays to test for specificity of this ADAM19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM19

Target: ADAM19 (Adam19) (ADAM Metallopeptidase Domain 19 (Adam19))

Alternative Name: ADAM19 (Adam19 Products)

Synonyms: AL024287 antibody, M[b] antibody, Mltnb antibody, MADDAM antibody, MLTNB antibody, Sox30 antibody, fksg34 antibody, maddam antibody, mltnb antibody, a disintegrin and metallopeptidase domain 19 (meltrin beta) antibody, ADAM metallopeptidase domain 19 antibody, ADAM metallopeptidase domain 19 S homeolog antibody, Adam19 antibody, ADAM19 antibody, adam19.S antibody

Background: ADAM19 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a type I transmembrane protein and serves as a marker for dendritic cell differentiation. It has also been demonstrated to be an active metalloproteinase, which may be involved in normal physiological and pathological processes such as cells migration, cell adhesion, cell-cell and cell-matrix interactions, and signal transduction. Alternative splicing results in two transcript variants.

Molecular Weight: 82 kDa (MW of target protein)