FZD10 antibody
-
- Target See all FZD10 Antibodies
- FZD10 (Frizzled Family Receptor 10 (FZD10))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FZD10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- FZD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF
- Top Product
- Discover our top product FZD10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FZD10 Blocking Peptide, catalog no. 33R-7152, is also available for use as a blocking control in assays to test for specificity of this FZD10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FZD10 (Frizzled Family Receptor 10 (FZD10))
- Alternative Name
- FZD10 (FZD10 Products)
- Synonyms
- CD350 antibody, FZ-10 antibody, Fz10 antibody, FzE7 antibody, hFz10 antibody, cFz-10 antibody, Fz-10 antibody, Xfr9 antibody, Xfz10 antibody, frizzled-10 antibody, frizzled10 antibody, fz10 antibody, fze7 antibody, hfz10 antibody, fk48e04 antibody, fz4 antibody, fzb antibody, wu:fk48e04 antibody, zg04 antibody, Xfz10A antibody, fzd10a antibody, Xfz10B antibody, Xfz9 antibody, fzd10b antibody, fzd9 antibody, frizzled class receptor 10 antibody, frizzled class receptor 10 L homeolog antibody, frizzled class receptor 10 S homeolog antibody, FZD10 antibody, fzd10 antibody, Fzd10 antibody, fzd10.L antibody, fzd10.S antibody
- Background
- FZD10 is a member of the frizzled family. Members of this family are 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
- Molecular Weight
- 65 kDa (MW of target protein)
- Pathways
- WNT Signaling
-