PILRB antibody (Middle Region)

Catalog No. ABIN635800

Product Details anti-PILRB Antibody

Target: PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PILRB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PILRB antibody was raised against the middle region of PILRB

Purification: Affinity purified

Immunogen: PILRB antibody was raised using the middle region of PILRB corresponding to a region with amino acids KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PILRB Blocking Peptide, catalog no. 33R-4545, is also available for use as a blocking control in assays to test for specificity of this PILRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PILRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PILRB

Target: PILRB (Paired Immunoglobin-Like Type 2 Receptor beta (PILRB))

Alternative Name: PILRB (PILRB Products)

Synonyms: FDFACT1 antibody, FDFACT2 antibody, FDFACT antibody, Fdact antibody, Pilrb antibody, paired immunoglobin-like type 2 receptor beta antibody, paired immunoglobin-like type 2 receptor beta 1 antibody, PILRB antibody, Pilrb1 antibody, Pilrb antibody

Background: Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRB is thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface.

Molecular Weight: 23 kDa (MW of target protein)