C6orf25 antibody (Chromosome 6 Open Reading Frame 25) (N-Term)

Details for Product anti-C6orf25 Antibody No. ABIN635805
Antigen
  • C6orf25
  • Ng31
  • G6b
  • NG31
  • LOC745085
  • G6B
  • megakaryocyte and platelet inhibitory receptor G6b
  • Mpig6b
  • MPIG6B
Epitope
N-Term
3
2
2
2
1
Reactivity
Human
26
18
17
1
1
1
1
1
Host
Rabbit
25
1
Clonality
Polyclonal
Conjugate
This C6orf25 antibody is un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
14
13
3
Options
Immunogen C6 ORF25 antibody was raised using the N terminal Of C6 rf25 corresponding to a region with amino acids AVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFP
Specificity C6 ORF25 antibody was raised against the N terminal Of C6 rf25
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others C6orf25 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name C6ORF25 (C6orf25 Antibody Abstract)
Background This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 23 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

C6ORF25 Blocking Peptide, catalog no. 33R-1591, is also available for use as a blocking control in assays to test for specificity of this C6ORF25 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Western Blotting (WB) image for anti-Chromosome 6 Open Reading Frame 25 (C6orf25) (N-Term) antibody (ABIN635805) C6ORF25 antibody used at 1 ug/ml to detect target protein.
Did you look for something else?