GALNT4 antibody
-
- Target See all GALNT4 Antibodies
- GALNT4 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 4 (GalNAc-T4) (GALNT4))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GALNT4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GALNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPEQKNYVGMQNCP
- Top Product
- Discover our top product GALNT4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GALNT4 Blocking Peptide, catalog no. 33R-1400, is also available for use as a blocking control in assays to test for specificity of this GALNT4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNT4 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 4 (GalNAc-T4) (GALNT4))
- Alternative Name
- GALNT4 (GALNT4 Products)
- Synonyms
- GALNAC-T4 antibody, GALNACT4 antibody, AV011803 antibody, polypeptide N-acetylgalactosaminyltransferase 4 antibody, polypeptide N-acetylgalactosaminyltransferase 4 L homeolog antibody, GALNT4 antibody, galnt4.L antibody, Galnt4 antibody
- Background
- GALNT4 catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It has a highest activity toward Muc7, EA2 and Muc2, with a lowest activity than GALNT2. This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes.
- Molecular Weight
- 67 kDa (MW of target protein)
-