WNT9B antibody (Middle Region)
-
- Target See all WNT9B Antibodies
- WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT9B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WNT9 B antibody was raised against the middle region of WNT9
- Purification
- Affinity purified
- Immunogen
- WNT9 B antibody was raised using the middle region of WNT9 corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA
- Top Product
- Discover our top product WNT9B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT9B Blocking Peptide, catalog no. 33R-1820, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))
- Alternative Name
- WNT9B (WNT9B Products)
- Synonyms
- WNT14B antibody, WNT15 antibody, WNT9B antibody, wnt-9b antibody, Wnt14b antibody, Wnt15 antibody, clf antibody, clf1 antibody, wnt-14b antibody, wnt-15 antibody, Wnt family member 9B antibody, wingless-type MMTV integration site family member 9B L homeolog antibody, protein Wnt-9b antibody, wingless-type MMTV integration site family, member 9B antibody, WNT9B antibody, wnt9b.2.L antibody, Wnt9b antibody, LOC468296 antibody, wnt9b antibody
- Background
- WNT9B is a ligand for members of the frizzled family of seven transmembrane receptors. WNT9B is a probable developmental protein. WNT9B may be a signaling molecule which affects the development of discrete regions of tissues. WNT9B is likely to signal over only few cell diameters.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- WNT Signaling, Tube Formation
-