CYP4F12 antibody (Middle Region)

Catalog No. ABIN635824

Product Details anti-CYP4F12 Antibody

Target: CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP4F12 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP4 F12 antibody was raised against the middle region of CYP4 12

Purification: Affinity purified

Immunogen: CYP4 F12 antibody was raised using the middle region of CYP4 12 corresponding to a region with amino acids DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP4F12 Blocking Peptide, catalog no. 33R-1964, is also available for use as a blocking control in assays to test for specificity of this CYP4F12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP4F12

Target: CYP4F12 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 12 (CYP4F12))

Alternative Name: CYP4F12 (CYP4F12 Products)

Synonyms: F22329_1 antibody, DKFZp469H0334 antibody, cytochrome P450 family 4 subfamily F member 12 antibody, cytochrome P450, family 4, subfamily F, polypeptide 12 antibody, cytochrome P450 4F12 antibody, CYP4F12 antibody, CpipJ_CPIJ016853 antibody, MCYG_08150 antibody

Background: CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid, however, its physiological function has not been determined.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process