GPD2 antibody

Catalog No. ABIN635827

Product Details anti-GPD2 Antibody

Target: GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPD2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPD2 Blocking Peptide, catalog no. 33R-3516, is also available for use as a blocking control in assays to test for specificity of this GPD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPD2

Target: GPD2 (Glycerol Phosphate Dehydrogenase 2, Mitochondrial (GPD2))

Alternative Name: GPD2 (GPD2 Products)

Synonyms: glycerol-3-phosphate dehydrogenase Gpd2 antibody, gpd2 antibody

Background: The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor.

Molecular Weight: 81 kDa (MW of target protein)