CYP1A1 antibody (Middle Region)

Catalog No. ABIN635829

Product Details anti-CYP1A1 Antibody

Target: CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP1A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP1 A1 antibody was raised against the middle region of CYP1 1

Purification: Affinity purified

Immunogen: CYP1 A1 antibody was raised using the middle region of CYP1 1 corresponding to a region with amino acids FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP1A1 Blocking Peptide, catalog no. 33R-2944, is also available for use as a blocking control in assays to test for specificity of this CYP1A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP1A1

Target: CYP1A1 (Cytochrome P450, Family 1, Subfamily A, Polypeptide 1 (CYP1A1))

Alternative Name: CYP1A1 (CYP1A1 Products)

Synonyms: AHH antibody, AHRR antibody, CP11 antibody, CYP1 antibody, P1-450 antibody, P450-C antibody, P450DX antibody, Cyp1a2 antibody, P450-1 antibody, cyp1a1 antibody, CYP1A1 antibody, CYPIA1 antibody, Cyp45c antibody, Cypc45c antibody, P-450MC antibody, wu:fb63b04 antibody, zfCYP1A antibody, zgc:109747 antibody, ahh antibody, ahrr antibody, cp11 antibody, cyp1 antibody, cyp1a antibody, p1-450 antibody, p450-c antibody, p450dx antibody, cytochrome P450 family 1 subfamily A member 1 antibody, cytochrome P450 1A1 antibody, cytochrome P450, family 1, subfamily a, polypeptide 1 antibody, cytochrome P450, family 1, subfamily A, polypeptide 1 antibody, cytochrome P450 family 1 subfamily D polypeptide 1 antibody, cytochrome P4501A1 antibody, polycyclic hydrocarbon-inducible cytochrome P450c antibody, cytochrome P450, family 1, subfamily A antibody, cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1 antibody, cytochrome P450 family 1 subfamily A member 1 L homeolog antibody, CYP1A1 antibody, CpipJ_CPIJ010542 antibody, Cyp1a1 antibody, cyp1d1 antibody, LOC100328613 antibody, cyp1a antibody, LOC102129994 antibody, cyp1a1.L antibody

Background: CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown, however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha