PERP antibody (Middle Region)
-
- Target See all PERP Antibodies
- PERP (TP53 Apoptosis Effector (PERP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PERP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PERP antibody was raised against the middle region of PERP
- Purification
- Affinity purified
- Immunogen
- PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG
- Top Product
- Discover our top product PERP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PERP Blocking Peptide, catalog no. 33R-2984, is also available for use as a blocking control in assays to test for specificity of this PERP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PERP (TP53 Apoptosis Effector (PERP))
- Alternative Name
- PERP (PERP Products)
- Synonyms
- KCP1 antibody, KRTCAP1 antibody, PIGPC1 antibody, RP3-496H19.1 antibody, THW antibody, dJ496H19.1 antibody, 1110017A08Rik antibody, kcp1 antibody, krtcap1 antibody, pigpc1 antibody, thw antibody, fk24g11 antibody, wu:fk24g11 antibody, PERP antibody, PERP, TP53 apoptosis effector antibody, PERP, TP53 apoptosis effector S homeolog antibody, PERP antibody, Perp antibody, perp.S antibody, perp antibody
- Background
- PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Positive Regulation of Endopeptidase Activity
-