PTPRA antibody (C-Term)

Catalog No. ABIN635883

Product Details anti-PTPRA Antibody

Target: PTPRA (Protein tyrosine Phosphatase, Receptor Type, A (PTPRA))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTPRA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTPRA antibody was raised against the C terminal of PTPRA

Purification: Affinity purified

Immunogen: PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTPRA Blocking Peptide, catalog no. 33R-8769, is also available for use as a blocking control in assays to test for specificity of this PTPRA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTPRA

Target: PTPRA (Protein tyrosine Phosphatase, Receptor Type, A (PTPRA))

Alternative Name: PTPRA (PTPRA Products)

Synonyms: PTPRA antibody, heptp antibody, hlpr antibody, hptpa antibody, hptpalpha antibody, lrp antibody, ptpa antibody, ptprl2 antibody, r-ptp-alpha antibody, rptpa antibody, HEPTP antibody, HLPR antibody, HPTPA antibody, HPTPalpha antibody, LRP antibody, PTPA antibody, PTPRL2 antibody, R-PTP-alpha antibody, RPTPA antibody, Ptpa antibody, Ptpalpha antibody, Rptpalpha antibody, Rptra antibody, Rptralpha antibody, RPTP[a] antibody, zf-RPTP[a] antibody, ptpa-a antibody, protein tyrosine phosphatase, receptor type A antibody, protein tyrosine phosphatase, receptor type, A antibody, protein tyrosine phosphatase, receptor type A S homeolog antibody, PTPRA antibody, ptpra antibody, Ptpra antibody, ptpra.S antibody

Background: PTPRA is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPRA contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. PTPRA has been shown to dephosphorylate and activate Src family tyrosine kinases, and is implicated in the regulation of integrin signaling, cell adhesion and proliferation.

Molecular Weight: 89 kDa (MW of target protein)