B4GALT3 antibody (Middle Region)
-
- Target See all B4GALT3 Antibodies
- B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B4GALT3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B4 GALT3 antibody was raised against the middle region of B4 ALT3
- Purification
- Affinity purified
- Immunogen
- B4 GALT3 antibody was raised using the middle region of B4 ALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
- Top Product
- Discover our top product B4GALT3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B4GALT3 Blocking Peptide, catalog no. 33R-6588, is also available for use as a blocking control in assays to test for specificity of this B4GALT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))
- Alternative Name
- B4GALT3 (B4GALT3 Products)
- Synonyms
- beta4Gal-T3 antibody, 9530061M23Rik antibody, AA104562 antibody, AW125175 antibody, ESTM26 antibody, ESTM6 antibody, R74981 antibody, b4Gal-T3 antibody, beta-1,4-galactosyltransferase 3 antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 S homeolog antibody, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3 antibody, B4GALT3 antibody, b4galt3.S antibody, B4galt3 antibody
- Background
- This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose, all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.
- Molecular Weight
- 44 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-