B4GALT3 antibody (Middle Region)

Catalog No. ABIN635885

Product Details anti-B4GALT3 Antibody

Target: B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B4GALT3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: B4 GALT3 antibody was raised against the middle region of B4 ALT3

Purification: Affinity purified

Immunogen: B4 GALT3 antibody was raised using the middle region of B4 ALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B4GALT3 Blocking Peptide, catalog no. 33R-6588, is also available for use as a blocking control in assays to test for specificity of this B4GALT3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B4GALT3

Target: B4GALT3 (UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3))

Alternative Name: B4GALT3 (B4GALT3 Products)

Synonyms: beta4Gal-T3 antibody, 9530061M23Rik antibody, AA104562 antibody, AW125175 antibody, ESTM26 antibody, ESTM6 antibody, R74981 antibody, b4Gal-T3 antibody, beta-1,4-galactosyltransferase 3 antibody, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 S homeolog antibody, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3 antibody, B4GALT3 antibody, b4galt3.S antibody, B4galt3 antibody

Background: This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose, all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process