ZIP2 antibody

Catalog No. ABIN635913

Product Details anti-ZIP2 Antibody

Target: ZIP2 (Slc39a2) (Solute Carrier Family 39 (Zinc Transporter), Member 2 (Slc39a2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZIP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC39 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC39A2 Blocking Peptide, catalog no. 33R-2468, is also available for use as a blocking control in assays to test for specificity of this SLC39A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZIP2

Target: ZIP2 (Slc39a2) (Solute Carrier Family 39 (Zinc Transporter), Member 2 (Slc39a2))

Alternative Name: SLC39A2 (Slc39a2 Products)

Synonyms: 6A1 antibody, ETI-1 antibody, ZIP-2 antibody, ZIP2 antibody, F730005G13Rik antibody, Gm1789 antibody, Gm289 antibody, Zip2 antibody, solute carrier family 39 member 2 antibody, solute carrier family 39 (zinc transporter), member 2 antibody, SLC39A2 antibody, Slc39a2 antibody

Background: This gene encodes a member of the ZIP family of metal ion transporters. The encoded protein functions as a zinc transporter. Mutations in this gene may be associated with susceptibility to carotid artery disease.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Autophagy