ALG1 antibody (N-Term)

Catalog No. ABIN635919

Product Details anti-ALG1 Antibody

Target: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALG1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALG1 antibody was raised against the N terminal of ALG1

Purification: Affinity purified

Immunogen: ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALG1 Blocking Peptide, catalog no. 33R-9885, is also available for use as a blocking control in assays to test for specificity of this ALG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALG1

Target: ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))

Alternative Name: ALG1 (ALG1 Products)

Synonyms: CDG1K antibody, HMAT1 antibody, HMT-1 antibody, HMT1 antibody, MT-1 antibody, Mat-1 antibody, hMat-1 antibody, zgc:66221 antibody, wu:fi34b12 antibody, alg1 antibody, hmat1 antibody, hmt1 antibody, ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase antibody, asparagine-linked glycosylation 1 (beta-1,4-mannosyltransferase) antibody, Beta-mannosyltransferase antibody, ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase L homeolog antibody, ALG1 antibody, Alg1 antibody, alg1 antibody, alg1.L antibody

Background: ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).

Molecular Weight: 52 kDa (MW of target protein)