CX3CL1 antibody
-
- Target See all CX3CL1 Antibodies
- CX3CL1 (Chemokine (C-X3-C Motif) Ligand 1 (CX3CL1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CX3CL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD
- Top Product
- Discover our top product CX3CL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABCD3 Blocking Peptide, catalog no. 33R-5113, is also available for use as a blocking control in assays to test for specificity of this ABCD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CX3CL1 (Chemokine (C-X3-C Motif) Ligand 1 (CX3CL1))
- Alternative Name
- ABCD3 (CX3CL1 Products)
- Synonyms
- ABCD3 antibody, CX3CL1 antibody, DKFZp459K117 antibody, Cx3c antibody, Scyd1 antibody, ABCD-3 antibody, C3Xkine antibody, CXC3 antibody, CXC3C antibody, NTN antibody, NTT antibody, SCYD1 antibody, fractalkine antibody, neurotactin antibody, AB030188 antibody, AI848747 antibody, CX3C antibody, Cxc3 antibody, D8Bwg0439e antibody, ATP binding cassette subfamily D member 3 antibody, C-X3-C motif chemokine ligand 1 antibody, chemokine (C-X3-C motif) ligand 1 antibody, ABCD3 antibody, CX3CL1 antibody, Cx3cl1 antibody, Abcd3 antibody
- Background
- The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
- Molecular Weight
- 75 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-