SLC13A2 antibody

Catalog No. ABIN635937

Product Details anti-SLC13A2 Antibody

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC13A2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC13 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC13A2 Blocking Peptide, catalog no. 33R-7231, is also available for use as a blocking control in assays to test for specificity of this SLC13A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC13A2

Target: SLC13A2 (Solute Carrier Family 13 Member 2 (SLC13A2))

Alternative Name: SLC13A2 (SLC13A2 Products)

Synonyms: NADC1 antibody, NaCT antibody, NaDC-1 antibody, SDCT1 antibody, Nadc1 antibody, mucin antibody, mNaDC-1 antibody, INDY antibody, nact antibody, slc13a2 antibody, slc13a5 antibody, wu:fd51b01 antibody, wu:fi13d08 antibody, wu:fi31b05 antibody, zgc:55601 antibody, zgc:77607 antibody, solute carrier family 13 member 2 antibody, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 antibody, solute carrier family 13 member 5 L homeolog antibody, SLC13A2 antibody, Slc13a2 antibody, slc13a5.L antibody, slc13a2 antibody

Background: SLC13A2 belongs to the SLC13A transporter family, NADC subfamily. It is a multi-pass membrane protein. SLC13A2 cotransports of sodium ions and dicarboxylates such as succinate and citrate.

Molecular Weight: 64 kDa (MW of target protein)