SLC30A1 antibody

Catalog No. ABIN635943

Product Details anti-SLC30A1 Antibody

Target: SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC30A1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC30 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC30A1 Blocking Peptide, catalog no. 33R-2860, is also available for use as a blocking control in assays to test for specificity of this SLC30A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC30A1

Target: SLC30A1 (Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1))

Alternative Name: SLC30A1 (SLC30A1 Products)

Synonyms: ZNT1 antibody, ZRC1 antibody, AI839647 antibody, C130040I11Rik antibody, Znt1 antibody, ZnT1 antibody, slc30 antibody, MGC53047 antibody, XZnSLC30 antibody, slc30a1 antibody, zgc:77589 antibody, zrc1 antibody, ZnT-1 antibody, ZNT8 antibody, ZnT-8 antibody, zinc transporter 1 precursor antibody, RGD1305098 antibody, zgc:162909 antibody, znt1 antibody, solute carrier family 30 member 1 antibody, solute carrier family 30 (zinc transporter), member 1 antibody, solute carrier family 30 member 1 L homeolog antibody, solute carrier family 30 (zinc transporter), member 1a antibody, solute carrier family 30 member 8 antibody, zinc transporter 1 precursor antibody, solute carrier family 30, member 10 antibody, solute carrier family 30 (zinc transporter), member 1b antibody, SLC30A1 antibody, Slc30a1 antibody, slc30a1.L antibody, slc30a1a antibody, slc30a1 antibody, SLC30A8 antibody, ZIP1 antibody, Slc30a10 antibody, slc30a1b antibody

Background: SLC30A1 may be involved in zinc transport out of the cell.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis