Oncostatin M Receptor antibody (Middle Region)
-
- Target See all Oncostatin M Receptor (OSMR) Antibodies
- Oncostatin M Receptor (OSMR)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Oncostatin M Receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- OSMR antibody was raised against the middle region of OSMR
- Purification
- Affinity purified
- Immunogen
- OSMR antibody was raised using the middle region of OSMR corresponding to a region with amino acids LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH
- Top Product
- Discover our top product OSMR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
OSMR Blocking Peptide, catalog no. 33R-5130, is also available for use as a blocking control in assays to test for specificity of this OSMR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSMR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Oncostatin M Receptor (OSMR)
- Alternative Name
- OSMR (OSMR Products)
- Synonyms
- OSMRB antibody, PLCA1 antibody, oncostatin M receptor antibody, OSMR antibody, Osmr antibody
- Background
- Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.
- Molecular Weight
- 110 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Growth Factor Binding
-