IL1RL1 antibody (N-Term)

Catalog No. ABIN635984

Product Details anti-IL1RL1 Antibody

Target: IL1RL1 (Interleukin 1 Receptor-Like 1 (IL1RL1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL1RL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL1 RL1 antibody was raised against the N terminal of IL1 L1

Purification: Affinity purified

Immunogen: IL1 RL1 antibody was raised using the N terminal of IL1 L1 corresponding to a region with amino acids RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL1RL1 Blocking Peptide, catalog no. 33R-8118, is also available for use as a blocking control in assays to test for specificity of this IL1RL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 L1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL1RL1

Target: IL1RL1 (Interleukin 1 Receptor-Like 1 (IL1RL1))

Alternative Name: IL1RL1 (IL1RL1 Products)

Synonyms: DER4 antibody, Fit-1 antibody, Ly84 antibody, ST2L antibody, St2 antibody, St2-rs1 antibody, T1 antibody, T1/ST2 antibody, FIT-1 antibody, IL33R antibody, ST2 antibody, ST2V antibody, FIT1 antibody, interleukin 1 receptor-like 1 antibody, interleukin 1 receptor like 1 antibody, Il1rl1 antibody, IL1RL1 antibody

Background: IL1RL1 is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gene, interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2) and interleukin 1 receptor-like 2 (IL1RL2) form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. Alternative splicing of this gene results in multiple transcript variants.

Molecular Weight: 61 kDa (MW of target protein)