TMEM9 antibody (C-Term)

Catalog No. ABIN635985

Product Details anti-TMEM9 Antibody

Target: TMEM9 (Transmembrane Protein 9 (TMEM9))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM9 antibody was raised against the C terminal of TMEM9

Purification: Affinity purified

Immunogen: TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM9 Blocking Peptide, catalog no. 33R-1863, is also available for use as a blocking control in assays to test for specificity of this TMEM9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM9

Target: TMEM9 (Transmembrane Protein 9 (TMEM9))

Alternative Name: TMEM9 (TMEM9 Products)

Synonyms: fi33g11 antibody, wu:fi33g11 antibody, zgc:55432 antibody, TMEM9A antibody, 1500015G18Rik antibody, AW545782 antibody, transmembrane protein 9 antibody, tmem9 antibody, TMEM9 antibody, Tmem9 antibody

Background: TMEM9 belongs to the TMEM9 family. It may be involved in intracellular transport.

Molecular Weight: 20 kDa (MW of target protein)